- More Files
- Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HDAC3.
Immunogen
HDAC3 (NP_003874, 319 a.a. ~ 428 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Applications
Western Blot (Cell lysate)
HDAC3 monoclonal antibody (M02), clone 3E11. Western Blot analysis of HDAC3 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
HDAC3 monoclonal antibody (M02), clone 3E11. Western Blot analysis of HDAC3 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
HDAC3 monoclonal antibody (M02), clone 3E11 Western Blot analysis of HDAC3 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
HDAC3 monoclonal antibody (M02), clone 3E11. Western Blot analysis of HDAC3 expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
ELISA
- Gene Info — HDAC3
- Interactome
- Disease