Recombinant EGF (Epidermal growth factor), Swine, AF
Référence orb1178909-100ug
Conditionnement : 100ug
Marque : Biorbyt
Recombinant EGF (Epidermal growth factor), Swine, AF
Catalog Number: orb1178909
Catalog Number | orb1178909 |
---|---|
Category | Proteins |
Description | Recombinant EGF (Epidermal growth factor), Swine, AF |
Tested applications | ELISA |
Reactivity | Porcine |
Tag | His-tag at the N-terminus |
Form/Appearance | Lyophilized |
Purity | > 95% as determined by SDS-PAGE. Ni-NTA chromatography. |
Entrez | 397083 |
Protein Sequence | MNSYSECPPSHDGYCLHGGVCMYIEAVDSYACNCVFGYVGERCQHRDLKWWELR with polyhistidine tag at the C-terminus. |
Source | Escherichia coli |
Endotoxins | < 0.1 EU per 1 μg of the protein by the LAL method. |
Storage | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Buffer/Preservatives | The protein was lyophilized from a solution containing 1X PBS, pH8.0. |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |