Recombinant IL-6 (Interleukin-6), Human, AF
Référence orb1179038-5ug
Conditionnement : 5ug
Marque : Biorbyt
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
Recombinant IL-6 (Interleukin-6), Human, AF
Catalog Number: orb1179038
| Catalog Number | orb1179038 |
|---|---|
| Category | Proteins |
| Description | Recombinant IL-6 (Interleukin-6), Human, AF |
| Tested applications | ELISA |
| Reactivity | Human |
| Tag | His-tag at the N-terminus |
| Form/Appearance | Lyophilized |
| Purity | > 98% as determined by SDS-PAGE. Ni-NTA chromatography. |
| Entrez | 3569 |
| Protein Sequence | MVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM with polyhistidine tag at the C-terminus. |
| Source | Escherichia coli |
| Biological Activity | Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is < 0.5 ng/mL. The specific activity of recombinant human IL-6 is approximately > 5 x 108 IU/mg. Measure by its ability to induce proliferation in MCF-7 cells. The ED50 for this effect is < 4.4 ng/mL. |
| Endotoxins | < 0.1 EU per 1 μg of the protein by the LAL method. |
| Storage | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
| Buffer/Preservatives | The protein was lyophilized from a solution containing 1X PBS, pH 8.0. |
| Alternative names | IFN-β2, B-Cell Differentiation Factor (BCDF), BSF- |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |