RHD antibody - C-terminal region
Référence ARP63085_P050
Conditionnement : 100ul
Marque : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-RHD (ARP63085_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Cow |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 79%; Human: 100% |
Peptide Sequence | Synthetic peptide located within the following region: DYHMNMMHIYVFAAYFGLSVAWCLPKPLPEGTEDKDQTATIPSLSAMLGA |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-RHD (ARP63085_P050) antibody is Catalog # AAP63085 |
Sample Type Confirmation | RHD is strongly supported by BioGPS gene expression data to be expressed in HEK293T, RPMI-8226 |
Gene Symbol | RHD |
---|---|
Gene Full Name | Rh blood group, D antigen |
Alias Symbols | RH, Rh4, RH30, RhII, RhPI, DIIIc, RHCED, RHDel, RHPII, RhDCw, CD240D, RHXIII, RHDVA(TT), RhK562-II |
NCBI Gene Id | 6007 |
Protein Name | Truncated RHD EMBL ACB87205.1 |
Description of Target | The Rh blood group system is the second most clinically significant of the blood groups, second only to ABO. It is also the most polymorphic of the blood groups, with variations due to deletions, gene conversions, and missense mutations. The Rh blood group includes this gene, which encodes the RhD protein, and a second gene that encodes both the RhC and RhE antigens on a single polypeptide. The two genes, and a third unrelated gene, are found in a cluster on chromosome 1. The classification of Rh-positive and Rh-negative individuals is determined by the presence or absence of the highly immunogenic RhD protein on the surface of erythrocytes. Multiple transcript variants encoding different isoforms have been found for this gene. |
Uniprot ID | B2LR45 |
Protein Accession # | ACB87205 |
Nucleotide Accession # | NM_001127691 |
Protein Size (# AA) | 297 |
Molecular Weight | 31kDa |
Protein Interactions | BAZ1B; |
-
What is the species homology for "RHD Antibody - C-terminal region (ARP63085_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Cow".
-
How long will it take to receive "RHD Antibody - C-terminal region (ARP63085_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "RHD Antibody - C-terminal region (ARP63085_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "RHD Antibody - C-terminal region (ARP63085_P050)"?
This target may also be called "RH, Rh4, RH30, RhII, RhPI, DIIIc, RHCED, RHDel, RHPII, RhDCw, CD240D, RHXIII, RHDVA(TT), RhK562-II" in publications.
-
What is the shipping cost for "RHD Antibody - C-terminal region (ARP63085_P050)"?
The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.
-
What is the guarantee for "RHD Antibody - C-terminal region (ARP63085_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "RHD Antibody - C-terminal region (ARP63085_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "31kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "RHD Antibody - C-terminal region (ARP63085_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "RHD"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "RHD"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "RHD"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "RHD"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "RHD"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "RHD"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.